Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein ydgC (ydgC)

This Recombinant Inner membrane protein ydgC (ydgC) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Inner membrane protein ydgC

UniProt

P0ACX1

Expression Region

1-111

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLVIKAALGALVVLLIGVLAKTKNYYIAGLIPLFPTFALIAHYIVASERGIEALRATII FSMWSIIPYFVYLVSLWYFTGMMRLPAAFVGSVACWGISAWVLIICWIKLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAG1 Antibody
KC-7475-01 50 μL

PAG1 Antibody

Sign In for Pricing
View Details
PAG1 Antibody
KC-7475-02 100 µL

PAG1 Antibody

Sign In for Pricing
View Details
PAG1 Antibody
KC-7475-03 1 mL

PAG1 Antibody

Sign In for Pricing
View Details
Cyclin B1 (V92.1), CF405S conjugate, 0.1mg/mL
BNC040680-500 1x 500 µL

Cyclin B1 (V92.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KCNA1 (NM_000217) Human Over-expression Lysate
LC400085 20 µg

KCNA1 (NM_000217) Human Over-expression Lysate

Sign In for Pricing
View Details
ARL4 (ARL4A) Rabbit Polyclonal Antibody
TA362235 100 µL

ARL4 (ARL4A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details