Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein ydgC (ydgC)

This Recombinant Inner membrane protein ydgC (ydgC) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Inner membrane protein ydgC

UniProt

P0ACX2

Expression Region

1-111

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLVIKAALGALVVLLIGVLAKTKNYYIAGLIPLFPTFALIAHYIVASERGIEALRATII FSMWSIIPYFVYLVSLWYFTGMMRLPAAFVGSVACWGISAWVLIICWIKLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monohydroxy Isodecyl Phthalate-d4
TRC-M547912-50MG 50 mg

Monohydroxy Isodecyl Phthalate-d4

Sign In for Pricing
View Details
4-(4-Chlorophenyl)-4-hydroxycyclohexanone
TRC-C379535-500MG 500 mg

4-(4-Chlorophenyl)-4-hydroxycyclohexanone

Sign In for Pricing
View Details
Usp10 Mouse Gene Knockout Kit (CRISPR)
KN518765 1 Kit

Usp10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FRK Antibody
8C10609-AAT 50 µg

FRK Antibody

Sign In for Pricing
View Details
TIMP2 Human Gene Knockout Kit (CRISPR)
KN209796BN 1 Kit

TIMP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Protein A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS
MTB06F4-PA/W 10x 96 Well Plates

Protein A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS

Sign In for Pricing
View Details