Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Universal stress protein B (uspB)

This Recombinant Enterobacter sp. Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Universal stress protein B

UniProt

A4WFT3

Expression Region

1-111

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISTVALFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQM RLVWYIYAQRYRDHHDDEFIRRCERLRCQFILTSALCGLVVVSMVALLIWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hippuric Acid
TRC-H356700-1G 1 g

Hippuric Acid

Sign In for Pricing
View Details
Cytokeratin 7 (OV-TL12/30), CF640R conjugate, 0.1mg/mL
BNC400683-500 1x 500 µL

Cytokeratin 7 (OV-TL12/30), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human ADPRH/ARH1 Protein (His Tag)
PKSH032047-01 10 µg

Recombinant Human ADPRH/ARH1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ADPRH/ARH1 Protein (His Tag)
PKSH032047-02 50 µg

Recombinant Human ADPRH/ARH1 Protein (His Tag)

Sign In for Pricing
View Details
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), CF594 conjugate, 0.1mg/mL
BNC942470-500 1x 500 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF568 conjugate, 0.1mg/mL
BNC681864-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details