Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Universal stress protein B (uspB)

This Recombinant Enterobacter sp. Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Universal stress protein B

UniProt

A4WFT3

Expression Region

1-111

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISTVALFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQM RLVWYIYAQRYRDHHDDEFIRRCERLRCQFILTSALCGLVVVSMVALLIWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC alpha (PRKCA) Rabbit Monoclonal Antibody
TA422902 100 µL

PKC alpha (PRKCA) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human Matriptase 2 (TMPRSS6) activation kit by CRISPRa
GA116114 1 Kit

Human Matriptase 2 (TMPRSS6) activation kit by CRISPRa

Sign In for Pricing
View Details
PIGT (NM_001184730) Human Over-expression Lysate
LY433142 100 µg

PIGT (NM_001184730) Human Over-expression Lysate

Sign In for Pricing
View Details
NOX1 (NM_007052) Human Over-expression Lysate
LY402083 100 µg

NOX1 (NM_007052) Human Over-expression Lysate

Sign In for Pricing
View Details
Tryptase (Mast Cell Marker) (TPSAB1/1963), CF405S conjugate, 0.1mg/mL
BNC041963-100 1x 100 µL

Tryptase (Mast Cell Marker) (TPSAB1/1963), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Actb Mouse Gene Knockout Kit (CRISPR)
KN500772 1 Kit

Actb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details