Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Universal stress protein B (uspB)

This Recombinant Enterobacter sp. Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Universal stress protein B

UniProt

A4WFT3

Expression Region

1-111

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISTVALFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQM RLVWYIYAQRYRDHHDDEFIRRCERLRCQFILTSALCGLVVVSMVALLIWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon
CS801383 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
ZFAND5 (NM_001102421) Human Over-expression Lysate
LY420148 100 µg

ZFAND5 (NM_001102421) Human Over-expression Lysate

Sign In for Pricing
View Details
Puromycin-D3 Dihydrochloride
TRC-P840322-2.5MG 2.5 mg

Puromycin-D3 Dihydrochloride

Sign In for Pricing
View Details
PON3 (NM_000940) Human Over-expression Lysate
LY400339 100 µg

PON3 (NM_000940) Human Over-expression Lysate

Sign In for Pricing
View Details
C11orf17 (AKIP1) Human Gene Knockout Kit (CRISPR)
KN205929RB 1 Kit

C11orf17 (AKIP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Loxapine-d8 Hydrochloride (Major)
TRC-L472753-5MG 5 mg

Loxapine-d8 Hydrochloride (Major)

Sign In for Pricing
View Details