Recombinant Escherichia coli O9:H4 Universal stress protein B (uspB)
This Recombinant Escherichia coli O9:H4 Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.
Product Specifications
Product Name Alternative
Universal stress protein B
UniProt
A8A5V1
Expression Region
1-111
Origin
Escherichia coli O9:H4 (strain HS)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC700391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740040-100 1x 100 µL
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 