Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O9:H4 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

This Recombinant Escherichia coli O9:H4 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE, L-Ara4N-phosphoundecaprenol flippase subunit ArnE, Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE

UniProt

A8A2C5

Expression Region

1-111

Origin

Escherichia coli O9:H4 (strain HS)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MZ2E/838), CF647 conjugate, 0.1mg/mL
BNC470838-100 1x 100 µL

MAGE A1 (MZ2E/838), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF640R conjugate, 0.1mg/mL
BNC401692-100 1x 100 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), CF488A conjugate, 0.1mg/mL
BNC882336-500 1x 500 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MALT-1 (MT1/410), CF405S conjugate, 0.1mg/mL
BNC040410-500 1x 500 µL

MALT-1 (MT1/410), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF488A conjugate, 0.1mg/mL
BNC882341-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details