Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Universal stress protein B (uspB)

This Recombinant Salmonella paratyphi A Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Universal stress protein B

UniProt

B5BHN6

Expression Region

1-111

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISTVSLFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTTHGQPNKQV RLVWYIYAQRYRDHHDEEFIRRCERVRRQFLLTSALCGLVVVSLIALMIWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tm7sf2 Mouse Gene Knockout Kit (CRISPR)
KN517646 1 Kit

Tm7sf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS804818 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
KEAP1 Human Gene Knockout Kit (CRISPR)
KN202189LP 1 Kit

KEAP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human COG3 activation kit by CRISPRa
GA113198 1 Kit

Human COG3 activation kit by CRISPRa

Sign In for Pricing
View Details
HARS1 (NM_002109) Human Over-expression Lysate
LY419527 100 µg

HARS1 (NM_002109) Human Over-expression Lysate

Sign In for Pricing
View Details
UBIAD1 Human Gene Knockout Kit (CRISPR)
KN402402 1 Kit

UBIAD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details