Recombinant Salmonella paratyphi A Universal stress protein B (uspB)
This Recombinant Salmonella paratyphi A Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.
Product Specifications
Product Name Alternative
Universal stress protein B
UniProt
B5BHN6
Expression Region
1-111
Origin
Salmonella paratyphi A (strain AKU_12601)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MISTVSLFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTTHGQPNKQV RLVWYIYAQRYRDHHDEEFIRRCERVRRQFLLTSALCGLVVVSLIALMIWH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
124406-FITC 100 µL
CBX5 (Chromobox Protein Homolog 5, Antigen p25, Heterochromatin Protein 1 Homolog alpha, HP1 alpha, HP1A) (FITC)
Sign In for Pricing
View Details 
