Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Universal stress protein B (uspB)

This Recombinant Salmonella paratyphi A Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Universal stress protein B

UniProt

B5BHN6

Expression Region

1-111

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISTVSLFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTTHGQPNKQV RLVWYIYAQRYRDHHDEEFIRRCERVRRQFLLTSALCGLVVVSLIALMIWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF488A conjugate, 0.1mg/mL
BNC882329-500 1x 500 µL

MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (COL-1 + CEA31 + C66/261), CF568 conjugate, 0.1mg/mL
BNC680747-100 1x 100 µL

CD66 (CEA) (COL-1 + CEA31 + C66/261), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human METTL4 activation kit by CRISPRa
GA112184 1 Kit

Human METTL4 activation kit by CRISPRa

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF594 conjugate, 0.1mg/mL
BNC941997-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ROR alpha (RORA) (NM_134261) Human Over-expression Lysate
LY403350 100 µg

ROR alpha (RORA) (NM_134261) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike S1 NTD (L18F, D80A, D215G, ΔLAL242-244, R246I) (His Tag)
PKSV030362 100 µg

Recombinant SARS-CoV-2 Spike S1 NTD (L18F, D80A, D215G, ΔLAL242-244, R246I) (His Tag)

Sign In for Pricing
View Details