Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O7:K1 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

This Recombinant Escherichia coli O7:K1 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE, L-Ara4N-phosphoundecaprenol flippase subunit ArnE, Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE

UniProt

B7NNT7

Expression Region

1-111

Origin

Escherichia coli O7:K1 (strain IAI39 / ExPEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF594 conjugate, 0.1mg/mL
BNC940851-500 1x 500 µL

HSP60 (LK1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF488A conjugate, 0.1mg/mL
BNC880305-500 1x 500 µL

CD95 (B-R18), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-500 1x 500 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF647 conjugate, 0.1mg/mL
BNC470512-500 1x 500 µL

CD68 (KP1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (PTPRC/1147), CF488A conjugate, 0.1mg/mL
BNC881147-500 1x 500 µL

CD45RB (PTPRC/1147), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF647 conjugate, 0.1mg/mL
BNC471577-100 1x 100 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details