Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

This Recombinant Salmonella paratyphi C Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE, L-Ara4N-phosphoundecaprenol flippase subunit ArnE, Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE

UniProt

C0Q066

Expression Region

1-111

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIGIVLVLASLLSVGGQLCQKQATRPLTTGRRRRHLMLWLGLALICMGAAMVLWLLVLQT LPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIILGSAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF647 conjugate, 0.1mg/mL
BNC471045-500 1x 500 µL

CD16 (C16/1045), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-500 1x 500 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), 1mg/mL
BNUM0040-50 1x 50 µL

CD35 / CR1 (E11), 1mg/mL

Sign In for Pricing
View Details
Endoglin / CD105 (ENG/1621), CF740 conjugate, 0.1mg/mL
BNC741621-100 1x 100 µL

Endoglin / CD105 (ENG/1621), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2956), CF740 conjugate, 0.1mg/mL
BNC742956-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2956), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details