Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ywrE (ywrE)

This Recombinant Bacillus subtilis Uncharacterized protein ywrE (ywrE) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Uncharacterized protein ywrE

UniProt

O05219

Expression Region

1-111

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNFWILMLIAITISLASQFFIKKKYGIDKSGWRYKHVSNTHKWIEITLLILFVFSLSFF PVEYLLLLFFIVIDSIRIFMEWHYRPEDKQYMYHIVEVSLMFMLLIYVCTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hemojuvelin Antibody, Mouse Monoclonal
MBS8102703-01 0.1 mL

Anti-Hemojuvelin Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-Hemojuvelin Antibody, Mouse Monoclonal
MBS8102703-02 5x 0.1 mL

Anti-Hemojuvelin Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Ubiquitin-Fold Modifier 1 (UFM1) Protein
abx260961-01 5 µg

Ubiquitin-Fold Modifier 1 (UFM1) Protein

Sign In for Pricing
View Details
Ubiquitin-Fold Modifier 1 (UFM1) Protein
abx260961-02 20 µg

Ubiquitin-Fold Modifier 1 (UFM1) Protein

Sign In for Pricing
View Details
Ubiquitin-Fold Modifier 1 (UFM1) Protein
abx260961-03 1 mg

Ubiquitin-Fold Modifier 1 (UFM1) Protein

Sign In for Pricing
View Details
Recombinant Human UHRF1 protein, His-tagged
UHRF1-294H 25 µg

Recombinant Human UHRF1 protein, His-tagged

Sign In for Pricing
View Details