Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ywrE (ywrE)

This Recombinant Bacillus subtilis Uncharacterized protein ywrE (ywrE) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Uncharacterized protein ywrE

UniProt

O05219

Expression Region

1-111

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNFWILMLIAITISLASQFFIKKKYGIDKSGWRYKHVSNTHKWIEITLLILFVFSLSFF PVEYLLLLFFIVIDSIRIFMEWHYRPEDKQYMYHIVEVSLMFMLLIYVCTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Coagulation Factor VIII (F8)
TRV-0016028-01 20 µL

Polyclonal Antibody to Coagulation Factor VIII (F8)

Sign In for Pricing
View Details
Polyclonal Antibody to Coagulation Factor VIII (F8)
TRV-0016028-02 100 µL

Polyclonal Antibody to Coagulation Factor VIII (F8)

Sign In for Pricing
View Details
Polyclonal Antibody to Coagulation Factor VIII (F8)
TRV-0016028-03 200 µL

Polyclonal Antibody to Coagulation Factor VIII (F8)

Sign In for Pricing
View Details
Polyclonal Antibody to Coagulation Factor VIII (F8)
TRV-0016028-04 1 mL

Polyclonal Antibody to Coagulation Factor VIII (F8)

Sign In for Pricing
View Details
Recombinant Human CD112 / Nectin-2 / PVRL2 Protein
E53A07771 50 µg

Recombinant Human CD112 / Nectin-2 / PVRL2 Protein

Sign In for Pricing
View Details
Mouse PERQ amino acid-rich with GYF domain-containing protein 2 (GIGYF2) ELISA Kit
abx538426 96 Tests

Mouse PERQ amino acid-rich with GYF domain-containing protein 2 (GIGYF2) ELISA Kit

Sign In for Pricing
View Details