Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Universal stress protein B (uspB)

This Recombinant Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Universal stress protein B

UniProt

Q664F8

Expression Region

1-111

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISTVALFWALCVVCVVNMARYYSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQI RLVGYIFAQRYLDHHDPEFIRRCERLRGQFILTSALCGLVVVSLVALMLWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DRB (LN-3 + HLA-DRB/1067), CF740 conjugate, 0.1mg/mL
BNC741208-100 1x 100 µL

HLA-DRB (LN-3 + HLA-DRB/1067), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (AC8), CF647 conjugate, 0.1mg/mL
BNC472378-500 1x 500 µL

P21WAF1 (Tumor Suppressor Protein) (AC8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
c Abl (ABL1) pTyr393/439 Rabbit Polyclonal Antibody
AP08038PU-S 50 µL

c Abl (ABL1) pTyr393/439 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Zkscan5 activation kit by CRISPRa
GA204727 1 Kit

Mouse Zkscan5 activation kit by CRISPRa

Sign In for Pricing
View Details
XFD610 alkyne
70065-AAT 1 mg

XFD610 alkyne

Sign In for Pricing
View Details
Decanoyl-Trp-(D-Asn)-Asp-Thr-Gly-Orn-Asp-(D-Ala)-OH Trifluoroacetic Acid Salt
TRC-D193360-10MG 10 mg

Decanoyl-Trp-(D-Asn)-Asp-Thr-Gly-Orn-Asp-(D-Ala)-OH Trifluoroacetic Acid Salt

Sign In for Pricing
View Details