Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Universal stress protein B (uspB)

This Recombinant Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Universal stress protein B

UniProt

Q664F8

Expression Region

1-111

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISTVALFWALCVVCVVNMARYYSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQI RLVGYIFAQRYLDHHDPEFIRRCERLRGQFILTSALCGLVVVSLVALMLWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGF2BP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H7]
TA501271AM 100 µL

IGF2BP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H7]

Sign In for Pricing
View Details
Metallothionein Antibody: ATTO 488
SPC-717D-A488 100 µg

Metallothionein Antibody: ATTO 488

Sign In for Pricing
View Details
Serotonin N acetyltransferase (AANAT) (N-term) Rabbit Polyclonal Antibody
AP50011PU-N 400 µL

Serotonin N acetyltransferase (AANAT) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF488A conjugate, 0.1mg/mL
BNC881553-500 1x 500 µL

MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CCDC66 activation kit by CRISPRa
GA117212 1 Kit

Human CCDC66 activation kit by CRISPRa

Sign In for Pricing
View Details
(R)-DRF053 Dihydrochloride
TRC-D678983-250MG 250 mg

(R)-DRF053 Dihydrochloride

Sign In for Pricing
View Details