Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R694 (MIMI_R694)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R694 (MIMI_R694) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Uncharacterized protein R694

UniProt

Q5UNU8

Expression Region

1-111

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHFSRCFDECSKIERPNVNKKLTRLIIVLFCLLCIIVTLGVIGYKFLFKMSYVDAIYNT AITTSTLGIAPGDKTDAEKIFTGIYAVLVGVFFISVISAIVSYMFTTYILD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB (DF-B1), Biotin conjugate, 0.1mg/mL
BNCB1066-100 1x 100 µL

CD45RB (DF-B1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calprotectin (MRP14) (S100A9) (CAGB/426), 0.2mg/mL
BNUB0426-100 1x 100 µL

Calprotectin (MRP14) (S100A9) (CAGB/426), 0.2mg/mL

Sign In for Pricing
View Details
TCF7L2 (NM_001198525) Human Over-expression Lysate
LY434261 100 µg

TCF7L2 (NM_001198525) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-CAPZA1
Y123102 100 µL

Anti-CAPZA1

Sign In for Pricing
View Details
ZNF274 Human Gene Knockout Kit (CRISPR)
KN200209LP 1 Kit

ZNF274 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), 0.2mg/mL
BNUB0679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), 0.2mg/mL

Sign In for Pricing
View Details