Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R694 (MIMI_R694)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R694 (MIMI_R694) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Uncharacterized protein R694

UniProt

Q5UNU8

Expression Region

1-111

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHFSRCFDECSKIERPNVNKKLTRLIIVLFCLLCIIVTLGVIGYKFLFKMSYVDAIYNT AITTSTLGIAPGDKTDAEKIFTGIYAVLVGVFFISVISAIVSYMFTTYILD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD147 Antibody[HIM6]
E-AB-F1056A-01 25 µg

Purified Anti-Human CD147 Antibody[HIM6]

Sign In for Pricing
View Details
Purified Anti-Human CD147 Antibody[HIM6]
E-AB-F1056A-02 100 µg

Purified Anti-Human CD147 Antibody[HIM6]

Sign In for Pricing
View Details
Tissue FFPE Sections, Rectum
CS702446 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details
MART-1 / Melan-A (A103), CF640R conjugate, 0.1mg/mL
BNC400668-100 1x 100 µL

MART-1 / Melan-A (A103), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF beta 3 Recombinant Rabbit monoclonal Antibody
HA751280 100 µL

TGF beta 3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TRIM39 antibody
FNab08984 100 µg

TRIM39 antibody

Sign In for Pricing
View Details