Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Universal stress protein B (uspB)

This Recombinant Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Universal stress protein B

UniProt

Q8ZA50

Expression Region

1-111

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISTVALFWALCVVCVVNMARYYSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQI RLVGYIFAQRYLDHHDPEFIRRCERLRGQFILTSALCGLVVVSLVALMLWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAR1 Rabbit pAb, IRDye 800CW conjugated
orb2850496 100 µL

PAR1 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Anti-Lymphotactin/XCL1 Antibody Picoband® Fluoro647 Conjugated
PB9681-Fluoro647 100 µg/Vial

Anti-Lymphotactin/XCL1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Recombinant Human SCML4 protein, His-tagged
SCML4-2995H 25 µg

Recombinant Human SCML4 protein, His-tagged

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) rpl2101 Polyclonal Antibody
MBS9013768 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) rpl2101 Polyclonal Antibody

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Neurokinin A (NKA)
MBS2129409-01 0.1 mL

APC_Cy7 Linked Polyclonal Antibody to Neurokinin A (NKA)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Neurokinin A (NKA)
MBS2129409-02 0.2 mL

APC_Cy7 Linked Polyclonal Antibody to Neurokinin A (NKA)

Sign In for Pricing
View Details