Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Universal stress protein B (uspB)

This Recombinant Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Universal stress protein B

UniProt

Q8ZA50

Expression Region

1-111

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISTVALFWALCVVCVVNMARYYSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQI RLVGYIFAQRYLDHHDPEFIRRCERLRGQFILTSALCGLVVVSLVALMLWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-hsa-miR-4781-3p Virus
mh2058 250 µL

AdmiRa-hsa-miR-4781-3p Virus

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 LPTB Polyclonal Antibody
MBS7165479 Inquire

Rabbit anti-Escherichia coli O157:H7 LPTB Polyclonal Antibody

Sign In for Pricing
View Details
FATE1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0759705 3x 1.0 µg

FATE1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Syntaxin 16/STX16 Rabbit Polyclonal Antibody (Fluoro488)
orb3101564 100 µg

Syntaxin 16/STX16 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Neutrophil Cytosolic Factor 2 (NCF2) Magnetic Luminex Assay Kit
LKU601572 96 Tests

Neutrophil Cytosolic Factor 2 (NCF2) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Human FAM116B (DENND6B) activation kit by CRISPRa
GA118415 1 Kit

Human FAM116B (DENND6B) activation kit by CRISPRa

Sign In for Pricing
View Details