Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Universal stress protein B (uspB)

This Recombinant Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Universal stress protein B

UniProt

Q8ZA50

Expression Region

1-111

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISTVALFWALCVVCVVNMARYYSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQI RLVGYIFAQRYLDHHDPEFIRRCERLRGQFILTSALCGLVVVSLVALMLWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Ephrin B Receptor 1/EphB1 (C-Fc)
PKSH034040-01 10 µg

Recombinant Human Ephrin B Receptor 1/EphB1 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human Ephrin B Receptor 1/EphB1 (C-Fc)
PKSH034040-02 50 µg

Recombinant Human Ephrin B Receptor 1/EphB1 (C-Fc)

Sign In for Pricing
View Details
(1S,2S,3R)-1,2,3-Trihydroxy-4-cyclopropene 2,3-Cyclohexyl Ketal
TRC-T795180-25MG 25 mg

(1S,2S,3R)-1,2,3-Trihydroxy-4-cyclopropene 2,3-Cyclohexyl Ketal

Sign In for Pricing
View Details
FGF21, Control Peptide (Fibroblast Growth Factor 21, FGF-21, UNQ3115/PRO10196)
148738 100 µg

FGF21, Control Peptide (Fibroblast Growth Factor 21, FGF-21, UNQ3115/PRO10196)

Sign In for Pricing
View Details
HBS1L Mouse Monoclonal Antibody [Clone ID: OTI1A7]
TA800552S 30 µL

HBS1L Mouse Monoclonal Antibody [Clone ID: OTI1A7]

Sign In for Pricing
View Details
NDUFB5 (F-2) Alexa Fluor® 594
sc-514245 AF594 200 µg/mL

NDUFB5 (F-2) Alexa Fluor® 594

Sign In for Pricing
View Details