Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C12C2.14c (SPBC12C2.14c)

This Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C12C2.14c (SPBC12C2.14c) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C12C2.14c

UniProt

Q9C0X4

Expression Region

1-111

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEELQYNFKKRRKTHNGISRFQRSALPLTIVYTIWSTFGSPCSGDQRVTLSITSILRKVQ DRRESEKKVKGKGREEYRRYYFFLLFYVSFPHIFLGLFFFIDKKILPFQSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4G1 (NM_004953) Human Recombinant Protein
TP312877M 100 µg

EIF4G1 (NM_004953) Human Recombinant Protein

Sign In for Pricing
View Details
CXCR2 Rabbit polyclonal Antibody
ER1906-87 100 µL

CXCR2 Rabbit polyclonal Antibody

Sign In for Pricing
View Details
CDK5RAP3 Antibody
8C12192-AAT 50 µg

CDK5RAP3 Antibody

Sign In for Pricing
View Details
Palmitic-8-13C acid
TRC-P144509-25MG 25 mg

Palmitic-8-13C acid

Sign In for Pricing
View Details
NGFR (Nerve Growth Factor Receptor) (NTR/912), CF740 conjugate, 0.1mg/mL
BNC740912-100 1x 100 µL

NGFR (Nerve Growth Factor Receptor) (NTR/912), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TNF Receptor II Recombinant Rabbit monoclonal Antibody
HA723405 100 µL

Human TNF Receptor II Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details