Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C12C2.14c (SPBC12C2.14c)

This Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C12C2.14c (SPBC12C2.14c) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C12C2.14c

UniProt

Q9C0X4

Expression Region

1-111

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEELQYNFKKRRKTHNGISRFQRSALPLTIVYTIWSTFGSPCSGDQRVTLSITSILRKVQ DRRESEKKVKGKGREEYRRYYFFLLFYVSFPHIFLGLFFFIDKKILPFQSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM55C Mouse Monoclonal Antibody [4-E11]
M1306-3 100 µL

FAM55C Mouse Monoclonal Antibody [4-E11]

Sign In for Pricing
View Details
2-(2-Ethoxyphenoxy)ethanamine
TRC-E892870-500MG 500 mg

2-(2-Ethoxyphenoxy)ethanamine

Sign In for Pricing
View Details
Rhodamine B
TRC-R318605-250G 250 g

Rhodamine B

Sign In for Pricing
View Details
NeuN Recombinant Chimeric Antibody Antibody
HA601397 100 µL

NeuN Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703811 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CFL1 Polyclonal Antibody
E-AB-40164-01 25 µL

CFL1 Polyclonal Antibody

Sign In for Pricing
View Details