Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. doylei ATP synthase subunit c (atpE)

This Recombinant Campylobacter jejuni subsp. doylei ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-112.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A7H3B5

Expression Region

1-112

Origin

Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKFLFLLLACAAVAFAAETNAPVEQEAINVWIKAFSVLAAGLGLGVAALGGAIGMGNTA AATIAGTARNPGLGPKLMTTMFIALAMIEAQVIYALVIALIALYANPFIVLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LIGHT, Human protein (His Tag)
PKSH034125-01 20 µg

Recombinant Human LIGHT, Human protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human LIGHT, Human protein (His Tag)
PKSH034125-02 100 µg

Recombinant Human LIGHT, Human protein (His Tag)

Sign In for Pricing
View Details
ScavengePore Phenethyldiethylamine
SC11208.5G 5 g

ScavengePore Phenethyldiethylamine

Sign In for Pricing
View Details
EvaEZTM Fluorometric DNA Polymerase Activity Assay (200 rxn)
#29051 2x 1 mL

EvaEZTM Fluorometric DNA Polymerase Activity Assay (200 rxn)

Sign In for Pricing
View Details
SERC3 Antibody
8C10988-AAT 50 µg

SERC3 Antibody

Sign In for Pricing
View Details
TRPM8 (NM_024080) Human Over-expression Lysate
LC402977 20 µg

TRPM8 (NM_024080) Human Over-expression Lysate

Sign In for Pricing
View Details