Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0145 (AF_0145)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0145 (AF_0145) spans the amino acid sequence from region 1-112.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0145

UniProt

O30092

Expression Region

1-112

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCRCRCMAMMSFVAIVTPLTMLTGLIDWKYRYDMRKVPIIQRKVITGIVGYVFVVVYVVL HSLTDYSLAALAMALVFFAITGEYGGKLVHGARTLLCLKNLRKGSSQKSNPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell adhesion molecule 2 (CADM2) Rabbit Polyclonal Antibody
TA372216 100 µL

Cell adhesion molecule 2 (CADM2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RIP3 (RIPK3) (Center) Rabbit Polyclonal Antibody
AP13847PU-N 400 µL

RIP3 (RIPK3) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: bilateral
CS714810 5x 5 µm

Tissue FFPE Sections, Ovary: bilateral

Sign In for Pricing
View Details
Human BTNL8 activation kit by CRISPRa
GA112723 1 Kit

Human BTNL8 activation kit by CRISPRa

Sign In for Pricing
View Details
Benzoyl-Arg-AMC
13478-AAT 5 mg

Benzoyl-Arg-AMC

Sign In for Pricing
View Details
GPR44 (PTGDR2) (NM_004778) Human Over-expression Lysate
LC401506 20 µg

GPR44 (PTGDR2) (NM_004778) Human Over-expression Lysate

Sign In for Pricing
View Details