Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0145 (AF_0145)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0145 (AF_0145) spans the amino acid sequence from region 1-112.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0145

UniProt

O30092

Expression Region

1-112

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCRCRCMAMMSFVAIVTPLTMLTGLIDWKYRYDMRKVPIIQRKVITGIVGYVFVVVYVVL HSLTDYSLAALAMALVFFAITGEYGGKLVHGARTLLCLKNLRKGSSQKSNPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOBL3 Antibody
8C11946-AAT 50 µg

MOBL3 Antibody

Sign In for Pricing
View Details
Tm7sf2 Mouse Gene Knockout Kit (CRISPR)
KN517646 1 Kit

Tm7sf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS503920 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
PEG3 (NM_006210) Human Over-expression Lysate
LY401879 100 µg

PEG3 (NM_006210) Human Over-expression Lysate

Sign In for Pricing
View Details
IGF2BP3 Antibody
KC-1257-01 50 μL

IGF2BP3 Antibody

Sign In for Pricing
View Details
IGF2BP3 Antibody
KC-1257-02 100 µL

IGF2BP3 Antibody

Sign In for Pricing
View Details