Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Invertebrate iridescent virus 3 Uncharacterized protein 112R (IIV3-112R)

This Recombinant Invertebrate iridescent virus 3 Uncharacterized protein 112R (IIV3-112R) spans the amino acid sequence from region 1-112.

Product Specifications

Product Name Alternative

Uncharacterized protein 112R

UniProt

Q196U8

Expression Region

1-112

Origin

Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRQVTPIYPRTNGTIQPVNFPIRNMEPPNHSLQSAGFQIPPPDAQFPRYHAAAPHHPRV EAAAPSCLDVARHVESCPICSRIHDTDKTLYVLVIVGLTILCFLLVKRILKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF640R conjugate, 0.1mg/mL
BNC400743-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), CF594 conjugate, 0.1mg/mL
BNC941976-500 1x 500 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1893), CF568 conjugate, 0.1mg/mL
BNC681893-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1893), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF568 conjugate, 0.1mg/mL
BNC680245-100 1x 100 µL

SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF640R conjugate, 0.1mg/mL
BNC401798-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL
BNC740523-500 1x 500 µL

AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details