Recombinant Pig Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1)
This Recombinant Pig Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) spans the amino acid sequence from region 2-113.
Product Specifications
Product Name Alternative
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1, Oligosaccharyl transferase subunit DAD1, EC= 2.4.1.119, Defender against cell death 1, DAD
UniProt
Q29036
Expression Region
2-113
Origin
Sus scrofa (Pig)
Field of Research
Neuroscience; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
SASVLSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFI SCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6012589-01 0.2 mL
C19orf39, ID (SWSAP1, C19orf39, ATPase SWSAP1, SWIM-type zinc finger 7-associated protein 1, SWS1-associated protein 1, ZSWIM7-associated protein 1)
Sign In for Pricing
View Details MBS6012589-02 5x 0.2 mL
C19orf39, ID (SWSAP1, C19orf39, ATPase SWSAP1, SWIM-type zinc finger 7-associated protein 1, SWS1-associated protein 1, ZSWIM7-associated protein 1)
Sign In for Pricing
View Details AAC23163-01 50 mg
3-[2- (4-Amino-1H-pyrazol-1-yl) ethyl]-1,3-oxazolidin-2-one
Sign In for Pricing
View Details