Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni ATP synthase subunit c (atpE)

This Recombinant Campylobacter jejuni ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-112.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q5HUM3

Expression Region

1-112

Origin

Campylobacter jejuni (strain RM1221)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKVLFLLLACAAVAFAAEINAPVEQEAINVWIKAFSVLAAGLGLGVAALGGAIGMGNTA AATIAGTARNPGLGPKLMTTMFIALAMIEAQVIYALVIALIALYANPFIVLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMS2 (NM_001099667) Human Over-expression Lysate
LY420481 100 µg

ARMS2 (NM_001099667) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772T3-01 20 Tests

Elab Fluor® Violet 540 Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772T3-02 100 Tests

Elab Fluor® Violet 540 Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772T3-03 2x 100 Tests

Elab Fluor® Violet 540 Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3048), CF568 conjugate, 0.1mg/mL
BNC683048-100 1x 100 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3048), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4’-Hydroxy Diclofenac-d4 Acyl Glucuronide
TRC-H825767-50MG 50 mg

4’-Hydroxy Diclofenac-d4 Acyl Glucuronide

Sign In for Pricing
View Details