Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni ATP synthase subunit c (atpE)

This Recombinant Campylobacter jejuni ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-112.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q5HUM3

Expression Region

1-112

Origin

Campylobacter jejuni (strain RM1221)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKVLFLLLACAAVAFAAEINAPVEQEAINVWIKAFSVLAAGLGLGVAALGGAIGMGNTA AATIAGTARNPGLGPKLMTTMFIALAMIEAQVIYALVIALIALYANPFIVLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRATD2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B5]
TA501921AM 100 µL

LRATD2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B5]

Sign In for Pricing
View Details
DL-Theanine
TRC-T405498-5MG 5 mg

DL-Theanine

Sign In for Pricing
View Details
Acrolein Diethyl Acetal
TRC-A191205-5G 5 g

Acrolein Diethyl Acetal

Sign In for Pricing
View Details
Rat Relaxin (RLN) ELISA Kit
RD-RLN-Ra-01 96 Tests

Rat Relaxin (RLN) ELISA Kit

Sign In for Pricing
View Details
Rat Relaxin (RLN) ELISA Kit
RD-RLN-Ra-02 48 Tests

Rat Relaxin (RLN) ELISA Kit

Sign In for Pricing
View Details
Mouse/Rat PDGF-BB Recombinant Rabbit monoclonal Antibody
HA723810 100 µL

Mouse/Rat PDGF-BB Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details