Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1)

This Recombinant Bovine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) spans the amino acid sequence from region 2-113.

Product Specifications

Product Name Alternative

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1, Oligosaccharyl transferase subunit DAD1, EC= 2.4.1.119, Defender against cell death 1, DAD

UniProt

Q5E9C2

Expression Region

2-113

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SASVLSVISRFLEEYLSATPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFI SCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCKR (NM_001486) Human Over-expression Lysate
LC400576 20 µg

GCKR (NM_001486) Human Over-expression Lysate

Sign In for Pricing
View Details
1-(5-Isoquinolinesulfonyl)piperazine Hydrochloride
TRC-I891000-50MG 50 mg

1-(5-Isoquinolinesulfonyl)piperazine Hydrochloride

Sign In for Pricing
View Details
Wnt11 Mouse Gene Knockout Kit (CRISPR)
KN519448 1 Kit

Wnt11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TPR Human Gene Knockout Kit (CRISPR)
KN214233LP 1 Kit

TPR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human WDR13 activation kit by CRISPRa
GA112112 1 Kit

Human WDR13 activation kit by CRISPRa

Sign In for Pricing
View Details
Glycyl-L-tyrosine
TRC-G720108-500MG 500 mg

Glycyl-L-tyrosine

Sign In for Pricing
View Details