Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD)

This Recombinant Chicken Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD) spans the amino acid sequence from region 46-157.

Product Specifications

Product Name Alternative

Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial, CybS, Succinate dehydrogenase complex subunit D, Succinate-ubiquinone oxidoreductase cytochrome b small subu

UniProt

Q5ZIS0

Expression Region

46-157

Origin

Gallus gallus (Chicken)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SHGGAPQGHGSSKAASLHWTSERAVSALLLGLLPAAYLYPGPAVDYSLAAALTLHGHWGL GQVITDYVHGDTPIKVANTGLYVLSAITFTGLCYFNYYDVGICKAVAMLWSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal USP20 / VDU2 Antibody (Internal)
APR02129G 0.05mg

Polyclonal USP20 / VDU2 Antibody (Internal)

Sign In for Pricing
View Details
STRA8 Rabbit pAb
E2161151 100 µL

STRA8 Rabbit pAb

Sign In for Pricing
View Details
PTPN11 Protein Lysate (Mouse) with C-HA Tag
38147034 100 µg

PTPN11 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Escherichia coli cvpA Protein (aa 1-162) (strain K12)
VAng-Lsx02261-50g 50 µg

Recombinant Escherichia coli cvpA Protein (aa 1-162) (strain K12)

Sign In for Pricing
View Details
FH (fumarate hydratase, HLRCC, LRCC, MCL, MCUL1) (MaxLight 405) discontinued
246119-ML405 100 µL

FH (fumarate hydratase, HLRCC, LRCC, MCL, MCUL1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Sacm1l AAV siRNA Pooled Vector
42968166 1.0 µg

Sacm1l AAV siRNA Pooled Vector

Sign In for Pricing
View Details