Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1)

This Recombinant Pongo abelii Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) spans the amino acid sequence from region 2-113.

Product Specifications

Product Name Alternative

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1, Oligosaccharyl transferase subunit DAD1, EC= 2.4.1.119, Defender against cell death 1, DAD

UniProt

Q5RBB4

Expression Region

2-113

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFI SCVGSFILAVRLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MED4 Antibody Picoband® Fluoro594 Conjugated
A06467-1-Fluoro594 100 µg/Vial

Anti-MED4 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal TDP-43/TARDBP Antibody [Dylight 680]
NB110-55376FR 0.1 mL

Rabbit Polyclonal TDP-43/TARDBP Antibody [Dylight 680]

Sign In for Pricing
View Details
TSGA10 antibody
FNab09042 100 µg

TSGA10 antibody

Sign In for Pricing
View Details
Macroh2a2 (NM_207000) Mouse Tagged ORF Clone
MG205746 10 µg

Macroh2a2 (NM_207000) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ZIM3 (NM_052882) Human Over-expression Lysate
LS114026-100ug 100 µg

ZIM3 (NM_052882) Human Over-expression Lysate

Sign In for Pricing
View Details
Poneratoxin
HY-P10234 1 Each

Poneratoxin

Sign In for Pricing
View Details