Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU04_1080 (ECU04_1080)

This Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU04_1080 (ECU04_1080) spans the amino acid sequence from region 1-112.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ECU04_1080

UniProt

Q8SVT0

Expression Region

1-112

Origin

Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAESVASSESLPQMKPEEPESKKSPSREAIPKDMPVVNVRDIMMYVENMEGMENKKLIPY VVYLDEQFKEIVQKRRKDARVVFIFMIAIMSMLVIGLVVCGVKLLGYLMEQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-100 1x 100 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF568 conjugate, 0.1mg/mL
BNC681555-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tal1 (BTL73), CF640R conjugate, 0.1mg/mL
BNC402852-500 1x 500 µL

Tal1 (BTL73), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF647 conjugate, 0.1mg/mL
BNC471700-100 1x 100 µL

CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details