Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pseudofirmus Na (+) /H (+) antiporter subunit C (mrpC)

This Recombinant Bacillus pseudofirmus Na (+) /H (+) antiporter subunit C (mrpC) spans the amino acid sequence from region 1-112.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C, Mrp complex subunit C, Multiple resistance and pH homeostasis protein C

UniProt

Q9RGZ3

Expression Region

1-112

Origin

Bacillus pseudofirmus (strain OF4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEILMSITAGVLFMVGTYLILTKSLLRVVVGLILLSHGAHLLLLTMAGLQRGAPPLLHLE ATTYSDPLPQALILTAIVISFGVTSFLLVLAYRTYKEHKTDDLDQLRGSADE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALAS2 Conjugated Antibody
MBS9456275-01 0.1 mL (Biotin)

ALAS2 Conjugated Antibody

Sign In for Pricing
View Details
ALAS2 Conjugated Antibody
MBS9456275-02 0.1 mL (AF350)

ALAS2 Conjugated Antibody

Sign In for Pricing
View Details
ALAS2 Conjugated Antibody
MBS9456275-03 0.1 mL (AF405)

ALAS2 Conjugated Antibody

Sign In for Pricing
View Details
ALAS2 Conjugated Antibody
MBS9456275-04 0.1 mL (AF488)

ALAS2 Conjugated Antibody

Sign In for Pricing
View Details
ALAS2 Conjugated Antibody
MBS9456275-05 0.1 mL (AF555)

ALAS2 Conjugated Antibody

Sign In for Pricing
View Details
ALAS2 Conjugated Antibody
MBS9456275-06 0.1 mL (AF594)

ALAS2 Conjugated Antibody

Sign In for Pricing
View Details