Recombinant Bacillus pseudofirmus Na (+) /H (+) antiporter subunit C (mrpC)
This Recombinant Bacillus pseudofirmus Na (+) /H (+) antiporter subunit C (mrpC) spans the amino acid sequence from region 1-112.
Product Specifications
Product Name Alternative
Na (+) /H (+) antiporter subunit C, Mrp complex subunit C, Multiple resistance and pH homeostasis protein C
UniProt
Q9RGZ3
Expression Region
1-112
Origin
Bacillus pseudofirmus (strain OF4)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEILMSITAGVLFMVGTYLILTKSLLRVVVGLILLSHGAHLLLLTMAGLQRGAPPLLHLE ATTYSDPLPQALILTAIVISFGVTSFLLVLAYRTYKEHKTDDLDQLRGSADE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx320627-03 100 µL
Amino-Terminal Enhancer of Split (AES) Antibody
Sign In for Pricing
View Details