Recombinant Bacillus pseudofirmus Na (+) /H (+) antiporter subunit C (mrpC)
This Recombinant Bacillus pseudofirmus Na (+) /H (+) antiporter subunit C (mrpC) spans the amino acid sequence from region 1-112.
Product Specifications
Product Name Alternative
Na (+) /H (+) antiporter subunit C, Mrp complex subunit C, Multiple resistance and pH homeostasis protein C
UniProt
Q9RGZ3
Expression Region
1-112
Origin
Bacillus pseudofirmus (strain OF4)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEILMSITAGVLFMVGTYLILTKSLLRVVVGLILLSHGAHLLLLTMAGLQRGAPPLLHLE ATTYSDPLPQALILTAIVISFGVTSFLLVLAYRTYKEHKTDDLDQLRGSADE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
222857-01 50 µL
GALK1 (GalactoKinase, Galactose Kinase, GALK1, GALK) discontinued
Sign In for Pricing
View Details 222857-02 100 µL
GALK1 (GalactoKinase, Galactose Kinase, GALK1, GALK) discontinued
Sign In for Pricing
View Details 
217815 100 µg
STUB1 (STIP1 Homology and U box-containing Protein 1, E3 Ubiquitin-protein Ligase CHIP, Antigen NY-CO-7, CLL-associated Antigen KW-8, Carboxy Terminus of Hsp70-interacting Protein, CHIP, PP1131, NY-CO-7, UBOX1) discontinued
Sign In for Pricing
View Details