Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus 229E Non-structural protein 4a (4a)

This Recombinant Human coronavirus 229E Non-structural protein 4a (4a) spans the amino acid sequence from region 22-133.

Product Specifications

Product Name Alternative

Non-structural protein 4a, ns4a, Accessory protein 4a

UniProt

P19739

Expression Region

22-133

Origin

Human coronavirus 229E (HCoV-229E)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KVSAEVSRQVIQDVKDGTVTFNLLAYTLMSLFVVYFALFKARSHRGRAALIVFKILILFV YVPLLYWSQAYIYATLIAVILLGRFFHTAWHCWLYKTWDFIVFNVTTLCYAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Enkephalin ELISA Kit
OM620619 96 Strip Well

Bovine Enkephalin ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Pigt shRNA (UAS) - Lentiviral mouse Pigt shRNA (UAS, GFP) plasmid
GTR15210310 1 Vial

Lentiviral mouse Pigt shRNA (UAS) - Lentiviral mouse Pigt shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human/Mouse ATG7 Alexa Fluor 750 Antibody (Clone 683906)
FAB6608S-100UG 100 µg

Human/Mouse ATG7 Alexa Fluor 750 Antibody (Clone 683906)

Sign In for Pricing
View Details
IGFBP2, CT (Insulin-like growth factor binding protein 2 36kD, BP2, IBP2, IBP-2, IGF-BP53)
350676 100 µg

IGFBP2, CT (Insulin-like growth factor binding protein 2 36kD, BP2, IBP2, IBP-2, IGF-BP53)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana F-box protein At4g27050 (At4g27050)
MBS1436902-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana F-box protein At4g27050 (At4g27050)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana F-box protein At4g27050 (At4g27050)
MBS1436902-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana F-box protein At4g27050 (At4g27050)

Sign In for Pricing
View Details