Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus 229E Non-structural protein 4a (4a)

This Recombinant Human coronavirus 229E Non-structural protein 4a (4a) spans the amino acid sequence from region 22-133.

Product Specifications

Product Name Alternative

Non-structural protein 4a, ns4a, Accessory protein 4a

UniProt

P19739

Expression Region

22-133

Origin

Human coronavirus 229E (HCoV-229E)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KVSAEVSRQVIQDVKDGTVTFNLLAYTLMSLFVVYFALFKARSHRGRAALIVFKILILFV YVPLLYWSQAYIYATLIAVILLGRFFHTAWHCWLYKTWDFIVFNVTTLCYAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)
TRV-0024899-01 200 µL

Biotin-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)
TRV-0024899-02 1 mL

Biotin-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)

Sign In for Pricing
View Details
Alpha B Crystallin Antibody (Biotin)
orb151547 200 µL

Alpha B Crystallin Antibody (Biotin)

Sign In for Pricing
View Details
NAP1L1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
31438066 1.0 µg DNA

NAP1L1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SUOX (Sulfite Oxidase, Mitochondrial) (AP) discontinued
134097-AP 100 µL

SUOX (Sulfite Oxidase, Mitochondrial) (AP) discontinued

Sign In for Pricing
View Details
Mouse FDX1L shRNA Plasmid
abx976514-01 150 µg

Mouse FDX1L shRNA Plasmid

Sign In for Pricing
View Details