Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus 229E Non-structural protein 4a (4a)

This Recombinant Human coronavirus 229E Non-structural protein 4a (4a) spans the amino acid sequence from region 22-133.

Product Specifications

Product Name Alternative

Non-structural protein 4a, ns4a, Accessory protein 4a

UniProt

P19739

Expression Region

22-133

Origin

Human coronavirus 229E (HCoV-229E)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KVSAEVSRQVIQDVKDGTVTFNLLAYTLMSLFVVYFALFKARSHRGRAALIVFKILILFV YVPLLYWSQAYIYATLIAVILLGRFFHTAWHCWLYKTWDFIVFNVTTLCYAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p38 Blocking Peptide
abx161932-01 1 mg

p38 Blocking Peptide

Sign In for Pricing
View Details
p38 Blocking Peptide
abx161932-02 5 mg

p38 Blocking Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF536 Antibody [Alexa Fluor 405]
NBP1-77092AF405 0.1 mL

Rabbit Polyclonal ZNF536 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Mouse IFNg ELISA Kit
E056205-01 1 Each

Mouse IFNg ELISA Kit

Sign In for Pricing
View Details
Mouse IFNg ELISA Kit
E056205-02 1 Each

Mouse IFNg ELISA Kit

Sign In for Pricing
View Details
TFRC Monoclonal Antibody, PE-Cy7 Conjugated
bsm-43165M-PE-Cy7 100 µL

TFRC Monoclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details