Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad-1 (dad-1)

This Recombinant Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad-1 (dad-1) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad-1, Oligosaccharyl transferase subunit dad-1, EC= 2.4.1.119, Defender against cell death 1, P

UniProt

P52872

Expression Region

1-113

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAQVVPVLSKLFDDYQKTTSSKLKIIDAYMTYILFTGIFQFIYCLLVGTFPFNSFLSGF ISTVTSFVLASCLRMQVNQENRSEFTAVSTERAFADFIFANLILHLVVVNFLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
BNC880017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-500 1x 500 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
BNC880352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DE-K18), CF568 conjugate, 0.1mg/mL
BNC680563-500 1x 500 µL

Cytokeratin 18 (DE-K18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF640R conjugate, 0.1mg/mL
BNC402341-500 1x 500 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), CF405S conjugate, 0.1mg/mL
BNC041576-100 1x 100 µL

Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details