Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Na (+) /H (+) antiporter subunit C1

This Recombinant Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1, Mrp complex subunit C1

UniProt

P60682

Expression Region

1-113

Origin

Staphylococcus aureus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DNAJC15 Rabbit Monoclonal Antibody, Carrier-free
M08200-carrier-free 100 µL

Anti-DNAJC15 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Alpha Synuclein antibody
20R-2432 0.05 mg

Alpha Synuclein antibody

Sign In for Pricing
View Details
WRCH1 Lentiviral Activation Particles (m2)
sc-427457-LAC-2 200 µL

WRCH1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Tnks 2, CT (TNKS2, PARP5B, TANK2, TNKL, Tankyrase-2, ADP-ribosyltransferase diphtheria toxin-like 6, Poly [ADP-ribose] polymerase 5B, TNKS-2, TRF1-interacting ankyrin-related ADP-ribose polymerase 2, Tankyrase II, Tankyrase-like protein, Tankyrase-related protein)
043096 200 µL

Tnks 2, CT (TNKS2, PARP5B, TANK2, TNKL, Tankyrase-2, ADP-ribosyltransferase diphtheria toxin-like 6, Poly [ADP-ribose] polymerase 5B, TNKS-2, TRF1-interacting ankyrin-related ADP-ribose polymerase 2, Tankyrase II, Tankyrase-like protein, Tankyrase-related protein)

Sign In for Pricing
View Details
SART3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
43032124 3x 1.0µg DNA

SART3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Phospho-CDK2 (Thr160) Antibody
CSB-PA912055 100 µL

Phospho-CDK2 (Thr160) Antibody

Sign In for Pricing
View Details