Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Na (+) /H (+) antiporter subunit C1

This Recombinant Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1, Mrp complex subunit C1

UniProt

P60682

Expression Region

1-113

Origin

Staphylococcus aureus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diisobutylsulfide
orb3023318-01 500 mg

Diisobutylsulfide

Sign In for Pricing
View Details
Diisobutylsulfide
orb3023318-02 1 g

Diisobutylsulfide

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)
MBS1399521-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)
MBS1399521-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)
MBS1399521-03 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)
MBS1399521-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD)

Sign In for Pricing
View Details