Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

P60681

Expression Region

1-113

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-RNF17 antibody
SL9163R-01 50 µL

Rabbit Anti-RNF17 antibody

Sign In for Pricing
View Details
Rabbit Anti-RNF17 antibody
SL9163R-02 100 µL

Rabbit Anti-RNF17 antibody

Sign In for Pricing
View Details
Msl3 Rabbit Polyclonal Antibody
TA363226 100 µL

Msl3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Girdin (phospho Ser1417) Rabbit Polyclonal Antibody
E28PP1096 100 µL

Girdin (phospho Ser1417) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Krox-20 Rabbit Polyclonal Antibody
orb381897 100 µg

Krox-20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Goat anti-Perilipin 1 (internal) Antibody
orb19462 100 µg

Goat anti-Perilipin 1 (internal) Antibody

Sign In for Pricing
View Details