Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

P60681

Expression Region

1-113

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal ANKRA2 antibody - C-terminal region
APR11414G 0.05mg

Polyclonal ANKRA2 antibody - C-terminal region

Sign In for Pricing
View Details
HnRNP H3 Polyclonal Antibody, Cy3 Conjugated
bs-17345R-Cy3 100 µL

HnRNP H3 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Calnexin (CANX) Antibody
abx128682-01 100 µL

Calnexin (CANX) Antibody

Sign In for Pricing
View Details
Calnexin (CANX) Antibody
abx128682-02 200 µL

Calnexin (CANX) Antibody

Sign In for Pricing
View Details
Calnexin (CANX) Antibody
abx128682-03 1 mL

Calnexin (CANX) Antibody

Sign In for Pricing
View Details
CD69 Rabbit Polyclonal Antibody
E28PT5463 100 µL

CD69 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details