Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

P60680

Expression Region

1-113

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ILT8/CD85b/LILRA6 Antibody (921330) [DyLight 594]
FAB8656M 0.1 mL

Mouse Monoclonal ILT8/CD85b/LILRA6 Antibody (921330) [DyLight 594]

Sign In for Pricing
View Details
KIN-59
C4148-50 50 mg

KIN-59

Sign In for Pricing
View Details
casein kinase IIα' Lentiviral Activation Particles (m2)
sc-419853-LAC-2 200 µL

casein kinase IIα' Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Rat Selenos / Selenoprotein S Recombinant Protein
R10141r 1 Each

Rat Selenos / Selenoprotein S Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal HSP27 Antibody [Dylight 755]
NBP1-75477IR 0.1 mL

Rabbit Polyclonal HSP27 Antibody [Dylight 755]

Sign In for Pricing
View Details
Hsa-miR-223-5p miRNA Agomir
CMJ0525-01 5 nmol

Hsa-miR-223-5p miRNA Agomir

Sign In for Pricing
View Details