Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

P60680

Expression Region

1-113

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,4',4'',4'''- ((2',5'-Dimethyl-[1,1':4',1''-terphenyl]-4,4''-diyl) bis (azanetriyl) ) tetrabenzaldehyde
OR1048785-01 100 mg

4,4',4'',4'''- ((2',5'-Dimethyl-[1,1':4',1''-terphenyl]-4,4''-diyl) bis (azanetriyl) ) tetrabenzaldehyde

Sign In for Pricing
View Details
4,4',4'',4'''- ((2',5'-Dimethyl-[1,1':4',1''-terphenyl]-4,4''-diyl) bis (azanetriyl) ) tetrabenzaldehyde
OR1048785-02 250 mg

4,4',4'',4'''- ((2',5'-Dimethyl-[1,1':4',1''-terphenyl]-4,4''-diyl) bis (azanetriyl) ) tetrabenzaldehyde

Sign In for Pricing
View Details
4,4',4'',4'''- ((2',5'-Dimethyl-[1,1':4',1''-terphenyl]-4,4''-diyl) bis (azanetriyl) ) tetrabenzaldehyde
OR1048785-03 1 g

4,4',4'',4'''- ((2',5'-Dimethyl-[1,1':4',1''-terphenyl]-4,4''-diyl) bis (azanetriyl) ) tetrabenzaldehyde

Sign In for Pricing
View Details
GPS1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2379148 100 µL

GPS1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
CKMT2 Antibody
A17407-50UL 50 μL

CKMT2 Antibody

Sign In for Pricing
View Details
Lgals9 (NM_012977) Rat Untagged Clone
RN205751 10 µg

Lgals9 (NM_012977) Rat Untagged Clone

Sign In for Pricing
View Details