Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

P60683

Expression Region

1-113

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human SPINT2 (Serine peptidase inhibitor, Kunitz type 2) Expressed in vitro E.coli expression system, Full Length of Mature Protein
MPX3753K Each

Magic™ Membrane Protein Human SPINT2 (Serine peptidase inhibitor, Kunitz type 2) Expressed in vitro E.coli expression system, Full Length of Mature Protein

Sign In for Pricing
View Details
Rat L-Selectin (L-Sel) ELISA kit
EIA05985r 1 Kit

Rat L-Selectin (L-Sel) ELISA kit

Sign In for Pricing
View Details
Oxyntomodulin (human) monoclonal antibody (20)
BPD-ABS-059-20-1 1 mg

Oxyntomodulin (human) monoclonal antibody (20)

Sign In for Pricing
View Details
TMEM102, NT (TMEM102, Transmembrane protein 102, Common beta-chain associated protein) (AP) discontinued
042934-AP 200 µL

TMEM102, NT (TMEM102, Transmembrane protein 102, Common beta-chain associated protein) (AP) discontinued

Sign In for Pricing
View Details
Recombinant EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Glycoprotein/GP1 Protein (His Tag)
MBS2569497-01 0.1 mg

Recombinant EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Glycoprotein/GP1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Glycoprotein/GP1 Protein (His Tag)
MBS2569497-02 5x 0.1 mg

Recombinant EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Glycoprotein/GP1 Protein (His Tag)

Sign In for Pricing
View Details