Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

P60683

Expression Region

1-113

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Gap junction alpha-4 protein, GJA4 ELISA KIT
ELI-08899h 96 Tests

Human Gap junction alpha-4 protein, GJA4 ELISA KIT

Sign In for Pricing
View Details
Anti-LFA-1 Antibody, Rabbit Polyclonal
MBS8100300-01 0.1 mL

Anti-LFA-1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-LFA-1 Antibody, Rabbit Polyclonal
MBS8100300-02 5x 0.1 mL

Anti-LFA-1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Rabbit Polyclonal BTN3A3 Antibody
NBP2-97920-100ul 100 µL

Rabbit Polyclonal BTN3A3 Antibody

Sign In for Pricing
View Details
Br Antibody
orb804367 2 mg

Br Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (2F11) [DyLight 650]
NBP2-22615C 0.1 mL

Mouse Monoclonal Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (2F11) [DyLight 650]

Sign In for Pricing
View Details