Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

P60683

Expression Region

1-113

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF564 Peptide
MBS3229835-01 0.1 mg

ZNF564 Peptide

Sign In for Pricing
View Details
ZNF564 Peptide
MBS3229835-02 5x 0.1 mg

ZNF564 Peptide

Sign In for Pricing
View Details
5-Amino-2,4-dichloropyridine
sc-267910 10 mg

5-Amino-2,4-dichloropyridine

Sign In for Pricing
View Details
RGD1308601 sgRNA CRISPR Lentivector set (Rat)
K6570101 3x 1.0 µg

RGD1308601 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
RPE AAV Vector (Mouse) (CMV)
40717104 1 µg

RPE AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
2-F-L-Phe(4-CF3)-OH
MBS9022371-01 1 g

2-F-L-Phe(4-CF3)-OH

Sign In for Pricing
View Details